Recombinant Human IL12B, StrepII-tagged

• Cat.No.: IL12B-272H
• Product Overview: Purified, full-length human recombinant IL12B protein (amino acids 23-328, 306 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 34.7 kDa. (Accession NP_002178.2; UniProt P29460)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 23-328, 306 a.a.
• Description: IL12B is a subunit of interleukin 12, a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. This cytokine is expressed by activated macrophages that serve as an essential inducer of Th1 cells development. This cytokine has been found to be important for sustaining a sufficient number of memory/effector Th1 cells to mediate long-term protection to an intracellular pathogen. IL12B also associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL23 activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVL SHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGA ATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLK NSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEW ASVPCS
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >80% by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: IL12B interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) [ Homo sapiens ]
• Official Symbol: IL12B
• Synonyms: IL12B; interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40); NKSF2; interleukin-12 subunit beta; CLMF; CLMF2; cytotoxic lymphocyte maturation factor 2; p40; IL 12B; IL12; subunit p40; interleukin 12; interleukin 12 beta chain; natural killer cell stimulatory factor; 40 kD subunit; natural killer cell stimulatory factor 2; NKSF; CLMF p40; IL-12 subunit p40; IL12, subunit p40; interleukin 12, p40; interleukin-12 beta chain; NK cell stimulatory factor chain 2; cytotoxic lymphocyte maturation factor 40 kDa subunit; natural killer cell stimulatory factor, 40 kD subunit; IL-12B
• Gene ID: 3593
• mRNA Refseq: NM_002187
• Protein Refseq: NP_002178
• MIM: 161561
• UniProt ID: P29460
• Chromosome Location: 5q31.1-q33.1
• Pathway: African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem
• Function: contributes_to cytokine activity; cytokine receptor activity; contributes_to growth factor activity; identical protein binding; interleukin-12 alpha subunit binding; interleukin-12 receptor binding; contributes_to interleukin-12 receptor binding; contributes_to interleukin-23 receptor binding; protein binding; protein heterodimerization activity; protein homodimerization activity