Recombinant Human IL12B protein, GST-tagged
Cat.No. : | IL12B-3091H |
Product Overview : | Recombinant Human IL12B protein(P29460)(23-328aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 23-328aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 61.7 kDa |
AA Sequence : | IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | IL12B interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) [ Homo sapiens ] |
Official Symbol | IL12B |
Synonyms | IL12B; interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40); NKSF2; interleukin-12 subunit beta; CLMF; CLMF2; cytotoxic lymphocyte maturation factor 2; p40; IL 12B; IL12; subunit p40; interleukin 12; interleukin 12 beta chain; natural killer cell stimulatory factor; 40 kD subunit; natural killer cell stimulatory factor 2; NKSF; CLMF p40; IL-12 subunit p40; IL12, subunit p40; interleukin 12, p40; interleukin-12 beta chain; NK cell stimulatory factor chain 2; cytotoxic lymphocyte maturation factor 40 kDa subunit; natural killer cell stimulatory factor, 40 kD subunit; IL-12B; |
Gene ID | 3593 |
mRNA Refseq | NM_002187 |
Protein Refseq | NP_002178 |
MIM | 161561 |
UniProt ID | P29460 |
◆ Recombinant Proteins | ||
Il12b-5647M | Active Recombinant Mouse Interleukin 12b, His-tagged | +Inquiry |
IL12B-576S | Recombinant Sheep IL12B Protein (23-327 aa), His-tagged | +Inquiry |
IL12B-29638TH | Recombinant Human IL12B, His-tagged | +Inquiry |
Il12b-5694M | Recombinant Mouse Il12b Protein (Met23-Ser335), C-His tagged | +Inquiry |
IL12B-180H | Active Recombinant Human IL12B Protein (Ile23-Ser328), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL12B-1197RCL | Recombinant Rat IL12B cell lysate | +Inquiry |
IL12B-1000MCL | Recombinant Marmoset IL12B cell lysate | +Inquiry |
IL12B-1101MCL | Recombinant Mouse IL12B cell lysate | +Inquiry |
IL12B-2731HCL | Recombinant Human IL12B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL12B Products
Required fields are marked with *
My Review for All IL12B Products
Required fields are marked with *
0
Inquiry Basket