Recombinant Human IL12 Protein, His-tagged
Cat.No. : | IL12-12H |
Product Overview : | Recombinant Human IL12 Protein with His tag was expressed in HEK293. |
Availability | March 31, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity. |
Form : | Liquid |
AA Sequence : | Alpha-chain:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASGGGGSHHHHHH Beta-chain: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
Purity : | > 90% determined by SDS-PAGE (Reduced) |
Storage : | Store at -20 to -80 centigrade. |
Storage Buffer : | PBS, pH 6.8 |
Gene Name | IL12A interleukin 12A [ Homo sapiens (human) ] |
Official Symbol | IL12A |
Synonyms | IL12A; interleukin 12A; P35; CLMF; NFSK; NKSF1; IL-12A; interleukin-12 subunit alpha; CLMF p35; IL-12, subunit p35; IL35 subunit; NF cell stimulatory factor chain 1; NK cell stimulatory factor chain 1; cytotoxic lymphocyte maturation factor 1, p35; cytotoxic lymphocyte maturation factor 35 kDa subunit; interleukin 12, p35; interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35); interleukin-12 alpha chain |
Gene ID | 3592 |
mRNA Refseq | NM_000882 |
Protein Refseq | NP_000873 |
MIM | 161560 |
UniProt ID | P29459 |
◆ Recombinant Proteins | ||
Il12-258I | Active Recombinant Rat Il12 Protein, His-tagged | +Inquiry |
IL12-28M | Active Recombinant Mouse IL12 protein, His-tagged | +Inquiry |
Il12-329M | Recombinant Mouse Il12, Fc-tagged | +Inquiry |
IL12-26R | Recombinant Rat IL12 protein, His-tagged | +Inquiry |
Il12b-175M | Active Recombinant Mouse interleukin 12 Protein, Flag tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL12 Products
Required fields are marked with *
My Review for All IL12 Products
Required fields are marked with *
0
Inquiry Basket