Recombinant Human IL10

• Cat.No.: IL10-28293TH
• Product Overview: Recombinant full length Human IL10 expressed in modified human 293 cells.

Specification

• Species: Human
• Tag: Non
• Description: The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. Mutations in this gene are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis.
• Tissue specificity: Produced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types.
• Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
• Storage: Store at +4°C.
• Sequences of amino acids: Theoretical Sequence:SPGQGTQSENSCTHFPGNLPNMLRDLRDA FSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSE MIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRR CHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDI FINYIEAYMTMKIRN
• Sequence Similarities: Belongs to the IL-10 family.
• Full Length: Full L.

Gene Information

• Gene Name: IL10 interleukin 10 [ Homo sapiens ]
• Official Symbol: IL10
• Synonyms: IL10; interleukin 10; interleukin-10; CSIF; cytokine synthesis inhibitory factor; IL 10; IL10A; T cell growth inhibitory factor; TGIF
• Gene ID: 3586
• mRNA Refseq: NM_000572
• Protein Refseq: NP_000563
• MIM: 124092
• Uniprot ID: P22301
• Chromosome Location: 1q31-q32
• Pathway: African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Amoebiasis, organism-specific biosystem
• Function: cytokine activity; growth factor activity; interleukin-10 receptor binding