Recombinant Human IL-32α Protein

Cat.No. : IL32-173H
Product Overview : Recombinant Human IL-32α Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Interleukin 32 alpha (IL-32 α) is one of six known splice variants of the IL-32 gene. IL-32 α induces the macrophage production of inflammatory cytokines, such as interleukin 8 (IL-8), tumor necrosis factor-alpha (TNF-α), and macrophage inflammatory protein 2 (MIP-2). IL-32 α expression is increased after the activation of T cells, natural killer (NK) cells, and interferon gamma-treated epithelial cells.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 14.9 kDa (131 aa)
AA Sequence : MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 50 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name IL32 interleukin 32 [ Homo sapiens (human) ]
Official Symbol IL32
Synonyms IL32; interleukin 32; interleukin-32; natural killer cell transcript 4; NK4; TAIF; TAIFb; TAIFd; interleukin-32 eta; interleukin-32 small; interleukin-32 theta; natural killer cells protein 4; tumor necrosis factor alpha-inducing factor; TAIFa; TAIFc; IL-32beta; IL-32alpha; IL-32delta; IL-32gamma;
Gene ID 9235
mRNA Refseq NM_001012631
Protein Refseq NP_001012649
MIM 606001
UniProt ID P24001

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL32 Products

Required fields are marked with *

My Review for All IL32 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon