Recombinant Human IGSF6 protein, T7/His-tagged

• Cat.No.: IGSF6-64H
• Product Overview: Recombinant human IGSF6 cDNA (28-153aa, derived from BC017844) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 28-153 a.a.
• Form: 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFCTLSVTQPWYLEVDYTHEAVTIKCTFSATGCPSEQPTCLWFRYGAH QPENLCLDGCKSEADKFTVREALKENQVSLTVNRVTSNDSAIYICGIAFPSVPEARAKQTGGGTTLVVREIKLLS KELRS
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro IGSF6 mediated CD40L activation regulation study for dendritic cells with this protein as either coating matrix protein or soluble factor.2. May be used for IGSF6 protein – protein interaction.3. May be used for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: IGSF6 immunoglobulin superfamily, member 6 [ Homo sapiens ]
• Official Symbol: IGSF6
• Synonyms: IGSF6; immunoglobulin superfamily, member 6; immunoglobulin superfamily member 6; DORA; down-regulated by activation (immunoglobulin superfamily)
• Gene ID: 10261
• mRNA Refseq: NM_005849
• Protein Refseq: NP_005840
• MIM: 606222
• UniProt ID: O95976
• Chromosome Location: 16p12.2
• Function: transmembrane signaling receptor activity