Recombinant Human IGSF21 Protein, GST-tagged

• Cat.No.: IGSF21-4352H
• Product Overview: Human MGC15730 partial ORF ( NP_116269, 201 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein which has two immunoglobulin (Ig) domains and is a member of the immunoglobulin superfamily. Proteins in this superfamily are usually found on or in cell membranes and act as receptors in immune response pathways. [provided by RefSeq, Sep 2011]
• Molecular Mass: 36.74 kDa
• AA Sequence: ASSGPLQDSRPFRSLLHRDLDDTKMQKSLSLLDAENRGGRPYTERPSRGLTPDPNILLQPTTENIPETVVSREFPRWVHSAEPTYFLRHSRTPSSDGTVE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IGSF21 immunoglobin superfamily, member 21 [ Homo sapiens ]
• Official Symbol: IGSF21
• Synonyms: IGSF21; immunoglobin superfamily, member 21; immunoglobulin superfamily member 21; MGC15730; RP11 121A23.1; FLJ41177
• Gene ID: 84966
• mRNA Refseq: NM_032880
• Protein Refseq: NP_116269
• UniProt ID: Q96ID5