Recombinant Human IGLL5 Protein (36-214 aa), His-tagged

Cat.No. : IGLL5-1636H
Product Overview : Recombinant Human IGLL5 Protein (36-214 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 36-214 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 21.3 kDa
AA Sequence : HGLLRPMVAPQSGDPDPGASVGSSRSSLRSLWGRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name IGLL5 immunoglobulin lambda like polypeptide 5 [ Homo sapiens (human) ]
Official Symbol IGLL5
Synonyms IGL; IGLV; VL-MAR;
Gene ID 100423062
mRNA Refseq NM_001178126
Protein Refseq NP_001171597
UniProt ID B9A064

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IGLL5 Products

Required fields are marked with *

My Review for All IGLL5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon