Recombinant Human IGFBP7 Protein, His-tagged
Cat.No. : | IGFBP7-303H |
Product Overview : | Recombinant human IGFBP7 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 282 |
Description : | This gene encodes a member of the insulin-like growth factor (IGF)-binding protein (IGFBP) family. IGFBPs bind IGFs with high affinity, and regulate IGF availability in body fluids and tissues and modulate IGF binding to its receptors. This protein binds IGF-I and IGF-II with relatively low affinity, and belongs to a subfamily of low-affinity IGFBPs. It also stimulates prostacyclin production and cell adhesion. Alternatively spliced transcript variants encoding different isoforms have been described for this gene, and one variant has been associated with retinal arterial macroaneurysm (PMID:21835307). |
Form : | Lyophilized |
Molecular Mass : | 27 kDa |
AA Sequence : | MERPSLRALLLGAAGLLLLLLPLSSSSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | IGFBP7 insulin-like growth factor binding protein 7 [ Homo sapiens (human) ] |
Official Symbol | IGFBP7 |
Synonyms | IGFBP7; insulin-like growth factor binding protein 7; insulin-like growth factor-binding protein 7; FSTL2; IGFBP 7; MAC25; PSF; IGFBP-rP1; angiomodulin; IGF-binding protein 7; PGI2-stimulating factor; tumor-derived adhesion factor; prostacyclin-stimulating factor; AGM; TAF; IBP-7; IGFBP-7; RAMSVPS; IGFBP-7v; IGFBPRP1; |
Gene ID | 3490 |
mRNA Refseq | NM_001253835 |
Protein Refseq | NP_001240764 |
MIM | 602867 |
UniProt ID | Q16270 |
◆ Recombinant Proteins | ||
IGFBP7-6957H | Active Recombinant Human IGFBP7 protein, His-tagged | +Inquiry |
IGFBP7-12177Z | Recombinant Zebrafish IGFBP7 | +Inquiry |
Igfbp7-1786M | Recombinant Mouse Igfbp7 protein, His & T7-tagged | +Inquiry |
IGFBP7-5054H | Recombinant Human Insulin-Like Growth Factor Binding Protein 7 | +Inquiry |
IGFBP7-529H | Recombinant Human IGFBP7 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGFBP7-1694HCL | Recombinant Human IGFBP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IGFBP7 Products
Required fields are marked with *
My Review for All IGFBP7 Products
Required fields are marked with *
0
Inquiry Basket