Recombinant Human IGFBP4 protein, T7/His-tagged
Cat.No. : | IGFBP4-60H |
Product Overview : | Recombinant human IGFBP4 cDNA (22-258aa, derived from BC016041) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 22-258 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPC GVYTPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQKH FAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHP ALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro IGFBP4 mediated VEGF pathway regulation study on endothelial cell growth with this protein as either coating matrix protein or as soluble factor. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | IGFBP4 insulin-like growth factor binding protein 4 [ Homo sapiens ] |
Official Symbol | IGFBP4 |
Synonyms | IGFBP4; insulin-like growth factor binding protein 4; insulin like growth factor binding protein 4; insulin-like growth factor-binding protein 4; BP 4; HT29 IGFBP; IBP4; IGF binding protein 4; IGFBP 4; IBP-4; IGF-binding protein 4; BP-4; IGFBP-4; HT29-IGF |
Gene ID | 3487 |
mRNA Refseq | NM_001552 |
Protein Refseq | NP_001543 |
MIM | 146733 |
UniProt ID | P22692 |
Chromosome Location | 17q12-q21.1 |
Pathway | Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem; Wnt signaling network, organism-specific biosystem; |
Function | insulin-like growth factor binding; |
◆ Recombinant Proteins | ||
IGFBP4-4429H | Recombinant Human IGFBP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
IGFBP4-5924C | Recombinant Chicken IGFBP4 | +Inquiry |
IGFBP4-184I | Active Recombinant Human IGFBP4 Protein, His-tagged | +Inquiry |
IGFBP4-2219R | Recombinant Rhesus monkey IGFBP4 Protein, His-tagged | +Inquiry |
IGFBP4-191H | Active Recombinant Human IGFBP4, Met-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGFBP4-2925MCL | Recombinant Mouse IGFBP4 cell lysate | +Inquiry |
IGFBP4-1231CCL | Recombinant Cynomolgus IGFBP4 cell lysate | +Inquiry |
IGFBP4-2926HCL | Recombinant Human IGFBP4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IGFBP4 Products
Required fields are marked with *
My Review for All IGFBP4 Products
Required fields are marked with *
0
Inquiry Basket