Recombinant Human IGFBP4 protein, T7/His-tagged

• Cat.No.: IGFBP4-60H
• Product Overview: Recombinant human IGFBP4 cDNA (22-258aa, derived from BC016041) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 22-258 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPC GVYTPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQKH FAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHP ALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro IGFBP4 mediated VEGF pathway regulation study on endothelial cell growth with this protein as either coating matrix protein or as soluble factor.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: IGFBP4 insulin-like growth factor binding protein 4 [ Homo sapiens ]
• Official Symbol: IGFBP4
• Synonyms: IGFBP4; insulin-like growth factor binding protein 4; insulin like growth factor binding protein 4; insulin-like growth factor-binding protein 4; BP 4; HT29 IGFBP; IBP4; IGF binding protein 4; IGFBP 4; IBP-4; IGF-binding protein 4; BP-4; IGFBP-4; HT29-IGF
• Gene ID: 3487
• mRNA Refseq: NM_001552
• Protein Refseq: NP_001543
• MIM: 146733
• UniProt ID: P22692
• Chromosome Location: 17q12-q21.1
• Pathway: Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem; Wnt signaling network, organism-specific biosystem
• Function: insulin-like growth factor binding