Recombinant Human IGFBP3 protein(121-200 aa), C-His-tagged

• Cat.No.: IGFBP3-2678H
• Product Overview: Recombinant Human IGFBP3 protein(P17936)(121-200 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 121-200 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 11 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: SRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNF

Gene Information

• Gene Name: IGFBP3 insulin-like growth factor binding protein 3 [ Homo sapiens ]
• Official Symbol: IGFBP3
• Synonyms: IGFBP3; insulin-like growth factor binding protein 3; insulin-like growth factor-binding protein 3; acid stable subunit of the 140 K IGF complex; binding protein 29; binding protein 53; BP 53; growth hormone dependent binding protein; IBP3; IGF binding protein 3; IBP-3; IGFBP-3; IGF-binding protein 3; growth hormone-dependent binding protein; BP-53
• Gene ID: 3486
• mRNA Refseq: NM_000598
• Protein Refseq: NP_000589
• MIM: 146732
• UniProt ID: P17936