Recombinant Human IGFBP3 protein(121-200 aa), C-His-tagged
Cat.No. : | IGFBP3-2678H |
Product Overview : | Recombinant Human IGFBP3 protein(P17936)(121-200 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 121-200 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 11 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | SRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNF |
Gene Name | IGFBP3 insulin-like growth factor binding protein 3 [ Homo sapiens ] |
Official Symbol | IGFBP3 |
Synonyms | IGFBP3; insulin-like growth factor binding protein 3; insulin-like growth factor-binding protein 3; acid stable subunit of the 140 K IGF complex; binding protein 29; binding protein 53; BP 53; growth hormone dependent binding protein; IBP3; IGF binding protein 3; IBP-3; IGFBP-3; IGF-binding protein 3; growth hormone-dependent binding protein; BP-53; |
Gene ID | 3486 |
mRNA Refseq | NM_000598 |
Protein Refseq | NP_000589 |
MIM | 146732 |
UniProt ID | P17936 |
◆ Recombinant Proteins | ||
IGFBP3-758H | Recombinant Human IGFBP3 protein(Gly28-Lys291), His-tagged | +Inquiry |
IGFBP3-145H | Active Recombinant Human Insulin-like Growth Factor Binding Protein 3 | +Inquiry |
IGFBP323022H | Recombinant Human IGFBP3 Protein | +Inquiry |
Igfbp3-10570M | Recombinant Mouse Igfbp3 Protein, His (Fc)-Avi-tagged | +Inquiry |
IGFBP3-830P | Recombinant Pig IGFBP3 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGFBP3-2927HCL | Recombinant Human IGFBP3 cell lysate | +Inquiry |
IGFBP3-1230CCL | Recombinant Cynomolgus IGFBP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IGFBP3 Products
Required fields are marked with *
My Review for All IGFBP3 Products
Required fields are marked with *
0
Inquiry Basket