Recombinant Human IGFBP3

• Cat.No.: IGFBP3-26377TH
• Product Overview: Recombinant full length Human IGFBP3 expressed in modified human 293 cells; amino acids 28-291 , Predicted MWt 28.7 kDa.

Specification

• Species: Human
• Tag: Non
• Protein Length: 28-291 a.a.
• Description: This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Tissue specificity: Expressed by most tissues. Present in plasma.
• Biological activity: Activity:The ED50 of IGFBP3-26377TH is typically 0.13-0.20 μg/ml as measured by its ability to neutralize rhIGF-II mediated proliferation of the MCF7 adenocarcinoma cell line.
• Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not rec
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
• Storage: Store at +4°C.
• Sequences of amino acids: GASSGGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGC GCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQ ALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEED RSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAK DSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMED TLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK
• Sequence Similarities: Contains 1 IGFBP N-terminal domain.Contains 1 thyroglobulin type-1 domain.
• Full Length: Full L.

Gene Information

• Gene Name: IGFBP3 insulin-like growth factor binding protein 3 [ Homo sapiens ]
• Official Symbol: IGFBP3
• Synonyms: IGFBP3; insulin-like growth factor binding protein 3; insulin-like growth factor-binding protein 3; acid stable subunit of the 140 K IGF complex; binding protein 29; binding protein 53; BP 53; growth hormone dependent binding protein; IBP3; IGF binding pr
• Gene ID: 3486
• mRNA Refseq: NM_000598
• Protein Refseq: NP_000589
• MIM: 146732
• Uniprot ID: P17936
• Chromosome Location: 7p13-p12
• Pathway: Diabetes pathways, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem
• Function: insulin-like growth factor I binding; insulin-like growth factor binding; metal ion binding; protein binding; protein tyrosine phosphatase activator activity