Recombinant Human IGDCC4 Protein, GST-tagged

• Cat.No.: IGDCC4-5988H
• Product Overview: Human NOPE partial ORF ( NP_066013, 1152 a.a. - 1250 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: IGDCC4 (Immunoglobulin Superfamily DCC Subclass Member 4) is a Protein Coding gene. An important paralog of this gene is PRTG.
• Molecular Mass: 36.63 kDa
• AA Sequence: DLEPEDPLPPEAPDLISGVGDPGQGAAWLDRELGGCELAAPGPDRLTCLPEAASASCSYPDLQPGEVLEETPGDSCQLKSPCPLGASPGLPRSPVSSSA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IGDCC4 immunoglobulin superfamily, DCC subclass, member 4 [ Homo sapiens ]
• Official Symbol: IGDCC4
• Synonyms: IGDCC4; immunoglobulin superfamily, DCC subclass, member 4; immunoglobulin superfamily DCC subclass member 4; likely ortholog of mouse neighbor of Punc E11; LOC57722; NOPE; hDDM36; neighbor of Punc E11; DDM36; FLJ42051; KIAA1628
• Gene ID: 57722
• mRNA Refseq: NM_020962
• Protein Refseq: NP_066013
• UniProt ID: Q8TDY8