Recombinant Human IFT46 Protein, GST-tagged

• Cat.No.: IFT46-477H
• Product Overview: Human C11orf60 full-length ORF ( AAH11647.1, 1 a.a. - 304 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 60.7 kDa
• AA Sequence: MADNSSDECEEENNKEKKKTSQLTPQRGFSENEDDDDDDDDSSETDSDSDDDDEEHGAPLEGAYDPADYEHLPVSAEIKELFQYISRYTPQLIDLDHKLKPFIPDFIPAVGDIDAFLKVPRPDGKPDNLGLLVLDEPSTKQSDPTVLSLWLTENSKQHNITQHMKVKSLEDAEKNPKAIDTWIESISELHRSKPPATVHYTRPMPDIDTLMQEWSPEFEELLGKVSLPTAEIDCSLAEYIDMICAILDIPVYKSRIQSLHLLFSLYSEFKNSQHFKALAEGKKAFTPSSNSTSQAGDMETLTFS
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IFT46 intraflagellar transport 46 homolog (Chlamydomonas) [ Homo sapiens ]
• Official Symbol: IFT46
• Synonyms: intraflagellar transport 46 homolog (Chlamydomonas); chromosome 11 open reading frame 60; C11orf2; UPF0360; C11orf60; intraflagellar transport protein 46 homolog; FLJ21827; intraflagellar transport protein IFT46
• Gene ID: 56912
• mRNA Refseq: NM_020153.3
• Protein Refseq: NP_064538.3
• UniProt ID: Q9NQC8