Recombinant Human IFNL2, StrepII-tagged
| Cat.No. : | IFNL2-298H |
| Product Overview : | Purified, full-length human recombinant IFNL2 (IL28A) protein (amino acids 26-200, 175 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 19.8 kDa. (Accession NP_742150.1; UniProt Q8IZJ0) |
- Specification
- Gene Information
- Related Products
- Download
| Description : | This is a cytokine distantly related to type I interferons and the IL-10 family. This protein, interleukin 29 (IL29), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). |
| Source : | Human Cells |
| Species : | Human |
| Tag : | StrepII |
| Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free) |
| Protein length : | 26-200, 175 a.a. |
| AA Sequence : | VPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEA ELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLE ASVTFNLFRLLTRDLNCVASGDLCV |
| Endotoxin : | <0.1 eu per μg protein by lal |
| Purity : | ~85% by SDS-PAGE |
| Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
| Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml |
| Gene Name | IL28A interleukin 28A (interferon, lambda 2) [ Homo sapiens ] |
| Official Symbol | IFNL2 |
| Synonyms | IL28A; interleukin 28A (interferon, lambda 2); interleukin 28A; interleukin-28A; IFNL2; IL 28A; IFN-lambda-2; cytokine Zcyto20; interferon lambda 2; interferon lambda-2; interferon-lambda 2; IL-28A; |
| Gene ID | 282616 |
| mRNA Refseq | NM_172138 |
| Protein Refseq | NP_742150 |
| MIM | 607401 |
| UniProt ID | Q8IZJ0 |
| Chromosome Location | 19q13.13 |
| Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; |
| Function | cytokine activity; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNL2 Products
Required fields are marked with *
My Review for All IFNL2 Products
Required fields are marked with *
0
Inquiry Basket
