Recombinant Human IFNGR1 Protein, C-His-tagged

• Cat.No.: IFNGR1-062H
• Product Overview: Recombinant Human IFNGR1 Protein with C-His tag was expressed in E. coli.

Specification

• Description: IFN-γ plays key roles in both the innate and adaptive immune response. IFN-γ activates the cytotoxic activity of innate immune cells, such as macrophages and NK cells. IFN-γ production by NK cells and antigen presenting cells (APCs) promotes cell-mediated adaptive immunity by inducing IFN-γ production by T lymphocytes, increasing class I and class II MHC expression, and enhancing peptide antigen presentation. The anti-viral activity of IFN-γ is due to its induction of PKR and other regulatory proteins. Binding of IFN-γ to the IFNGR1/IFNGR2 complex promotes dimerization of the receptor complexes to form the (IFNGR1/IFNGR2)2 -IFN-γ dimer. Binding induces a conformational change in receptor intracellular domains and signaling involves Jak1, Jak2, and Stat1. The critical role of IFN-γ in amplification of immune surveillance and function is supported by increased susceptibility to pathogen infection by IFN-γ or IFNGR knockout mice and in humans with inactivating mutations in IFNGR1 or IFNGR2. IFN-γ also appears to have a role in atherosclerosis.
• Source: E. coli
• Species: Human
• Tag: His
• Molecular Mass: ~25 kDa
• AA Sequence: EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: IFNGR1 interferon gamma receptor 1 [ Homo sapiens (human) ]
• Official Symbol: IFNGR1
• Synonyms: IFNGR1; interferon gamma receptor 1; IFNGR; CD119; CDw119; AVP, type 2; IFN-gamma-R1; CD119 antigen; IFN-gamma receptor 1; antiviral protein, type 2; immune interferon receptor 1; interferon-gamma receptor alpha chain; FLJ45734
• Gene ID: 3459
• mRNA Refseq: NM_000416
• Protein Refseq: NP_000407
• MIM: 107470
• UniProt ID: P15260