Recombinant Human IFNGR1 Protein, C-His-tagged
Cat.No. : | IFNGR1-062H |
Product Overview : | Recombinant Human IFNGR1 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | IFN-γ plays key roles in both the innate and adaptive immune response. IFN-γ activates the cytotoxic activity of innate immune cells, such as macrophages and NK cells. IFN-γ production by NK cells and antigen presenting cells (APCs) promotes cell-mediated adaptive immunity by inducing IFN-γ production by T lymphocytes, increasing class I and class II MHC expression, and enhancing peptide antigen presentation. The anti-viral activity of IFN-γ is due to its induction of PKR and other regulatory proteins. Binding of IFN-γ to the IFNGR1/IFNGR2 complex promotes dimerization of the receptor complexes to form the (IFNGR1/IFNGR2)2 -IFN-γ dimer. Binding induces a conformational change in receptor intracellular domains and signaling involves Jak1, Jak2, and Stat1. The critical role of IFN-γ in amplification of immune surveillance and function is supported by increased susceptibility to pathogen infection by IFN-γ or IFNGR knockout mice and in humans with inactivating mutations in IFNGR1 or IFNGR2. IFN-γ also appears to have a role in atherosclerosis. |
Molecular Mass : | ~25 kDa |
AA Sequence : | EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | IFNGR1 interferon gamma receptor 1 [ Homo sapiens (human) ] |
Official Symbol | IFNGR1 |
Synonyms | IFNGR1; interferon gamma receptor 1; IFNGR; CD119; CDw119; AVP, type 2; IFN-gamma-R1; CD119 antigen; IFN-gamma receptor 1; antiviral protein, type 2; immune interferon receptor 1; interferon-gamma receptor alpha chain; FLJ45734; |
Gene ID | 3459 |
mRNA Refseq | NM_000416 |
Protein Refseq | NP_000407 |
MIM | 107470 |
UniProt ID | P15260 |
◆ Recombinant Proteins | ||
Ifngr1-7039M | Recombinant Mouse Ifngr1 protein, GST-tagged | +Inquiry |
Ifngr1-6953M | Active Recombinant Mouse Ifngr1 protein, hFc-tagged | +Inquiry |
IFNGR1-4253H | Recombinant Human IFNGR1 Protein (Met1-Gly245), C-His tagged | +Inquiry |
IFNGR1-7855H | Recombinant Human IFNGR1 protein, His-Flag-tagged | +Inquiry |
IFNGR1-105C | Recombinant Cynomolgus IFNGR1, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNGR1-1003CCL | Recombinant Cynomolgus IFNGR1 cell lysate | +Inquiry |
IFNGR1-1175RCL | Recombinant Rat IFNGR1 cell lysate | +Inquiry |
IFNGR1-1775MCL | Recombinant Mouse IFNGR1 cell lysate | +Inquiry |
IFNGR1-2646HCL | Recombinant Human IFNGR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNGR1 Products
Required fields are marked with *
My Review for All IFNGR1 Products
Required fields are marked with *
0
Inquiry Basket