Recombinant Human IFNG therapeutic protein (Interferon gamma-1b)

Cat.No. : IFNG-P011H
Product Overview : Human Interferon gamma-1b (140 residues), produced from E. coli. Production of Actimmune is achieved by fermentation of a genetically engineered Escherichia coli bacterium containing the DNA which encodes for the human protein. Purification of the product is achieved by conventional column chromatography. The sequence displayed is a cDNA sequence which codes for human interferon gamma, as described by Gray et. al. and not specifically interferon gamma 1b.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 146aa
Description : This gene encodes a member of the type II interferon family. The protein encoded is a soluble cytokine with antiviral, immunoregulatory and anti-tumor properties and is a potent activator of macrophages. Mutations in this gene are associated with aplastic anemia. The expression product is the active ingredient of Actimmune.
Molecular Mass : 17.1 Kda
AA Sequence : CYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQK SVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGR RASQ
Endotoxin : < 1.0 EU per μg of the protein
Purity : >95%
Storage : Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Alias : IFNG; IFN-gamma; IFG; IFI; Interferon gamma-1b
Gene Name IFNG interferon, gamma [ Homo sapiens ]
Official Symbol IFNG
Synonyms IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI;
Gene ID 3458
mRNA Refseq NM_000619
Protein Refseq NP_000610
MIM 147570
UniProt ID P01579
Chromosome Location 12q14
Pathway ATF-2 transcription factor network, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem;
Function cytokine activity; interferon-gamma receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNG Products

Required fields are marked with *

My Review for All IFNG Products

Required fields are marked with *

0
cart-icon
0
compare icon