Recombinant Human IFNAR1 protein(458-557 aa), His-tagged

• Cat.No.: IFNAR1-3263H
• Product Overview: Recombinant Human IFNAR1 protein(458-557 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 458-557 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AASequence: KVFLRCINYVFFPSLKPSSSIDEYFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: IFNAR1 interferon (alpha, beta and omega) receptor 1 [ Homo sapiens ]
• Official Symbol: IFNAR1
• Synonyms: IFNAR1; interferon (alpha, beta and omega) receptor 1; IFNAR; interferon alpha/beta receptor 1; IFRC; CRF2-1; IFN-R-1; IFN-alpha/beta receptor 1; interferon-beta receptor 1; beta-type antiviral protein; alpha-type antiviral protein; type I interferon receptor 1; cytokine receptor class-II member 1; cytokine receptor family 2 member 1; interferon-alpha/beta receptor alpha chain; AVP; IFNBR; IFN-alpha-REC
• Gene ID: 3454
• mRNA Refseq: NM_000629
• Protein Refseq: NP_000620
• MIM: 107450
• UniProt ID: P17181