Recombinant Human IFNA6 Protein, His-tagged
Cat.No. : | IFNA6-194H |
Product Overview : | Recombinant Human IFNA6 fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
Molecular Mass : | 21.1kD |
AA Sequence : | SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKEVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | IFNA6 interferon, alpha 6 [ Homo sapiens ] |
Official Symbol | IFNA6 |
Synonyms | IFNA6; interferon, alpha 6; interferon alpha-6; IFN alphaK; leIF K; IFN-alpha-6; interferon alpha-K; interferon alpha-54; IFN-alphaK; |
Gene ID | 3443 |
mRNA Refseq | NM_021002 |
Protein Refseq | NP_066282 |
MIM | 147566 |
UniProt ID | P05013 |
◆ Recombinant Proteins | ||
Ifna6-620M | Recombinant Mouse Ifna6 Protein, His/GST-tagged | +Inquiry |
IFNA6-3592H | Recombinant Human IFNA6 Protein (Ser21-Glu189), C-His tagged | +Inquiry |
IFNA6-195H | Recombinant Human IFNA6 Protein, His-tagged | +Inquiry |
IFNA6-191H | Recombinant Human IFNA6 protein, GST-tagged | +Inquiry |
IFNA6-194H | Recombinant Human IFNA6 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNA6-5279HCL | Recombinant Human IFNA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNA6 Products
Required fields are marked with *
My Review for All IFNA6 Products
Required fields are marked with *
0
Inquiry Basket