Recombinant Human IFNA16 protein, His-tagged

• Cat.No.: IFNA16-7443H
• Product Overview: Recombinant Human IFNA16 protein(P05015)(24-189aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• ProteinLength: 24-189aa
• Tag: C-His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 20.8 kDa
• AASequence: CDLPQTHSLGNRRALILLAQMGRISHFSCLKDRYDFGFPQEVFDGNQFQKAQAISAFHEMIQQTFNLFSTKDSSAAWDETLLDKFYIELFQQLNDLEACVTQEVGVEEIALMNEDSILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: IFNA16 interferon, alpha 16 [ Homo sapiens ]
• Official Symbol: IFNA16
• Synonyms: IFNA16; interferon, alpha 16; interferon alpha-16; IFN alphaO; IFN-alpha-16; IFN-alpha-N-protein; interferon alpha-WA; IFN-alphaO
• Gene ID: 3449
• mRNA Refseq: NM_002173
• Protein Refseq: NP_002164
• MIM: 147580
• UniProt ID: P05015