Recombinant Human IFNA1 protein
Cat.No. : | IFNA1-06H |
Product Overview : | Recombinant Human IFNA1 alpha 1a protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 167 |
Description : | IFN-αs are proteins secreted by leukocyte. They are mainly involved in innate immune response against viral infection. The IFN-α family has 13 subtypes and 23 different variants. The individual proteins have molecular masses between 19-26 kDa and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN-α subtypes possess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN-alpha subtypes differ in their sequences at only one or two positions. Naturally occurring variants also include proteins truncated by 10 amino acids at the carboxy-terminal end. |
Form : | Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4, containing 3 % Mannitol, 5 % Trehalose, 0.05 % Tween-80. |
Bio-activity : | Fully biologically active when compared to standard. The specific activity determined by an anti-viral assay is no less than 1.0 × 10⁸ IU/mg. |
Molecular Mass : | Approximately 19.5 kDa, a single non-glycosylated polypeptide chain containing 167 amino acids. |
AA Sequence : | MCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE |
Endotoxin : | Less than 0.1 EU/µg of rHuIFN-α1a as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IFNA1 |
Official Symbol | IFNA1 |
Synonyms | IFNA1; interferon, alpha 1; interferon alpha-1/13; IFL; IFN; IFN ALPHA; IFN alpha 1b; IFN alphaD; IFNA13; IFNA@; interferon alpha 1b; leIF D; IFN-alpha 1b; IFN-alpha-1/13; interferon-alpha1; interferon alpha-D; IFN-ALPHA; IFN-alphaD; MGC138207; MGC138505; MGC138507; |
Gene ID | 3439 |
mRNA Refseq | NM_024013 |
Protein Refseq | NP_076918 |
MIM | 147660 |
UniProt ID | P01562 |
◆ Recombinant Proteins | ||
IFNA1-636G | Recombinant Guinea pig IFNA1 protein, His & T7-tagged | +Inquiry |
IFNA1-0875H | Recombinant Human IFNA1 Protein (C24-E189), Tag Free | +Inquiry |
Ifna1-1026M | Active Recombinant Mouse Ifna1 protein, His-tagged | +Inquiry |
IFNA1-07H | Recombinant Human IFNA1 protein | +Inquiry |
Ifna1-487R | Recombinant Rat Ifna1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNA1-1513RCL | Recombinant Rat IFNA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNA1 Products
Required fields are marked with *
My Review for All IFNA1 Products
Required fields are marked with *
0
Inquiry Basket