Recombinant Human IFITM1 Protein, GST-tagged

• Cat.No.: IFITM1-45H
• Product Overview: Recombinant Human IFITM Protein()() is expressed from E. coli with a GST Tag at the N-terminal.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• Bio-activity: Not tested.
• Protein length: 1-125 aa
• AA Sequence: MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY
• Endotoxin: Please contact the lab for more information.
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
  If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
  Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
• Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below).

Gene Information

• Gene Name: IFITM1
• Official Symbol: IFITM1
• Synonyms: 9-27; CD225; IFI17; LEU13
• Gene ID: 8519
• mRNA Refseq: NM_003641.5
• Protein Refseq: NP_003632.4
• MIM: 604456
• UniProt ID: P13164