Recombinant Human IFI16

• Cat.No.: IFI16-26947TH
• Product Overview: Recombinant fragment corresponding to amino acids 630-729 of Human IFI16, with N terminal proprietary tag; predicted MWt 36.63 kDa inclusive of tag. AAH17059; Q16666 isoform 2

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein interactions. The protein localizes to the nucleoplasm and nucleoli, and interacts with p53 and retinoblastoma-1. It modulates p53 function, and inhibits cell growth in the Ras/Raf signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF

Gene Information

• Gene Name: IFI16 interferon, gamma-inducible protein 16 [ Homo sapiens ]
• Official Symbol: IFI16
• Synonyms: IFI16; interferon, gamma-inducible protein 16; gamma-interferon-inducible protein 16; IFNGIP1; PYHIN2
• Gene ID: 3428
• mRNA Refseq: NM_001206567
• Protein Refseq: NP_001193496
• MIM: 147586
• Uniprot ID: Q16666
• Chromosome Location: 1q22
• Pathway: Id Signaling Pathway, organism-specific biosystem; Senescence and Autophagy, organism-specific biosystem
• Function: DNA binding; double-stranded DNA binding; protein binding