Recombinant Human IDO2 protein, His-tagged

• Cat.No.: IDO2-2516H
• Product Overview: Recombinant Human IDO2 protein(1-135 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-135 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MLHFHYYDTSNKIMEPHRPNVKTAVPLSLESYHISEEYGFLLPDSLKELPDHYRPWMEIANKLPQLIDAHQLQAHVDKMPLLSCQFLKGHREQRLAHLVLSFLTMGYVWQEGEAQPAEVLPRNLALPFVEVSRNL
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: IDO2 indoleamine 2,3-dioxygenase 2 [ Homo sapiens ]
• Official Symbol: IDO2
• Synonyms: IDO2; indoleamine 2,3-dioxygenase 2; INDOL1, indoleamine pyrrole 2,3 dioxygenase like 1; IDO-2; indoleamine 2,3-dioxygenase-like 1 protein; indoleamine 2,3-dioxygenase-like protein 1; indoleamine-pyrrole 2,3 dioxygenase-like 1; indoleamine-pyrrole 2,3-dioxygenase-like protein 1; INDOL1
• Gene ID: 169355
• mRNA Refseq: NM_194294
• Protein Refseq: NP_919270
• MIM: 612129
• UniProt ID: Q6ZQW0