Recombinant Human ID1 protein, Arginine-tagged

• Cat.No.: ID1-146H
• Product Overview: Recombinant human ID1 protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: KVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRL KELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDR ILCRLEESGGGGSPGRRRRRRRRRRR
• Purity: >90% by SDS-PAGE
• Applications: 1. Protein transduction for epithelial cells in vitro cell differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
• Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.

Gene Information

• Gene Name: ID1 inhibitor of DNA binding 1, dominant negative helix-loop-helix protein [ Homo sapiens ]
• Official Symbol: ID1
• Synonyms: ID1; dJ857M17.1.2; DNA binding protein inhibitor ID 1; inhibitor of differentiation 1; class B basic helix-loop-helix protein 24
• Gene ID: 3397
• mRNA Refseq: NM_002165
• Protein Refseq: NP_002156
• MIM: 600349
• UniProt ID: P41134
• Chromosome Location: 20q11
• Pathway: ALK1 signaling events, organism-specific biosystem; IL-3 Signaling Pathway, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem
• Function: protein binding