Recombinant Human ICA1 protein, GST-tagged

Cat.No. : ICA1-28632TH
Product Overview : Recombinant Human ICA1(1 a.a. - 110 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-110 a.a.
Description : This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.84 kDa
AA Sequence : MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAG
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name ICA1 islet cell autoantigen 1, 69kDa [ Homo sapiens ]
Official Symbol ICA1
Synonyms ICA1; islet cell autoantigen 1, 69kDa; islet cell autoantigen 1 (69kD); islet cell autoantigen 1; ICAp69; p69; islet cell autoantigen p69; 69 kDa islet cell autoantigen; islet cell autoantigen 1 isoform; diabetes mellitus type I autoantigen; ICA69;
Gene ID 3382
mRNA Refseq NM_022307
Protein Refseq NP_071682
MIM 147625
UniProt ID Q05084
Chromosome Location 7p22
Pathway Type I diabetes mellitus, organism-specific biosystem; Type I diabetes mellitus, conserved biosystem;
Function molecular_function; protein domain specific binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ICA1 Products

Required fields are marked with *

My Review for All ICA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon