Recombinant Human ICA1 protein, GST-tagged

• Cat.No.: ICA1-28632TH
• Product Overview: Recombinant Human ICA1(1 a.a. - 110 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 1-110 a.a.
• Description: This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.84 kDa
• AA Sequence: MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAG
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: ICA1 islet cell autoantigen 1, 69kDa [ Homo sapiens ]
• Official Symbol: ICA1
• Synonyms: ICA1; islet cell autoantigen 1, 69kDa; islet cell autoantigen 1 (69kD); islet cell autoantigen 1; ICAp69; p69; islet cell autoantigen p69; 69 kDa islet cell autoantigen; islet cell autoantigen 1 isoform; diabetes mellitus type I autoantigen; ICA69
• Gene ID: 3382
• mRNA Refseq: NM_022307
• Protein Refseq: NP_071682
• MIM: 147625
• UniProt ID: Q05084
• Chromosome Location: 7p22
• Pathway: Type I diabetes mellitus, organism-specific biosystem; Type I diabetes mellitus, conserved biosystem
• Function: molecular_function; protein domain specific binding