Recombinant Human IBSP Protein, His-SUMO-tagged
Cat.No. : | IBSP-1251H |
Product Overview : | Recombinant Human IBSP Protein (129-281aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 129-281 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 32.4 kDa |
AA Sequence : | AIQLPKKAGDITNKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNGSSGGDNG EEGEEESVTGANAEDTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGA NEYDNGYEIYESE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | IBSP integrin-binding sialoprotein [ Homo sapiens ] |
Official Symbol | IBSP |
Synonyms | IBSP; integrin-binding sialoprotein; bone sialoprotein 2; bone sialoprotein; bone sialoprotein II; BSP; BSP II; SP II; cell-binding sialoprotein; BNSP; SP-II; BSP-II |
Gene ID | 3381 |
mRNA Refseq | NM_004967 |
Protein Refseq | NP_004958 |
MIM | 147563 |
UniProt ID | P21815 |
◆ Recombinant Proteins | ||
IBSP-7966M | Recombinant Mouse IBSP Protein | +Inquiry |
IBSP-4400M | Recombinant Mouse IBSP Protein, His (Fc)-Avi-tagged | +Inquiry |
IBSP-12HFL | Active Recombinant Full Length Human IBSP Protein, His-tagged | +Inquiry |
IBSP-377H | Recombinant Human IBSP Protein, His&SUMO-tagged | +Inquiry |
Ibsp-600M | Active Recombinant Mouse Ibsp Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IBSP Products
Required fields are marked with *
My Review for All IBSP Products
Required fields are marked with *
0
Inquiry Basket