Recombinant Human IBSP Protein, His-SUMO-tagged

• Cat.No.: IBSP-1251H
• Product Overview: Recombinant Human IBSP Protein (129-281aa) was expressed in E. coli with N-terminal His-SUMO-tag.

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 32.4 kDa
• AA Sequence: AIQLPKKAGDITNKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNGSSGGDNG
  EEGEEESVTGANAEDTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGA
  NEYDNGYEIYESE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Protein length: 129-281 a.a.

Gene Information

• Gene Name: IBSP integrin-binding sialoprotein [ Homo sapiens ]
• Official Symbol: IBSP
• Synonyms: IBSP; integrin-binding sialoprotein; bone sialoprotein 2; bone sialoprotein; bone sialoprotein II; BSP; BSP II; SP II; cell-binding sialoprotein; BNSP; SP-II; BSP-II
• Gene ID: 3381
• mRNA Refseq: NM_004967
• Protein Refseq: NP_004958
• MIM: 147563
• UniProt ID: P21815