Recombinant Human IBA1 protein, GST-tagged

• Cat.No.: IBA1-14028H
• Product Overview: Recombinant Human IBA1 protein(1-147 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-GST
• Protein length: 1-147 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: AIF1 allograft inflammatory factor 1 [ Homo sapiens ]
• Official Symbol: AIF1
• Synonyms: AIF1; allograft inflammatory factor 1; AIF 1; Em:AF129756.17; IBA1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; IRT 1; protein G1; ionized calcium-binding adapter molecule 1; allograft inflammatory factor-1 splice variant Hara-1; IRT1; AIF-1; IRT-1; IBA1
• Gene ID: 199
• mRNA Refseq: NM_001623
• Protein Refseq: NP_001614
• MIM: 601833
• UniProt ID: P55008