Recombinant Human IAPP Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: IAPP-153H
• Product Overview: IAPP MS Standard C13 and N15-labeled recombinant protein (NP_000406) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: This gene encodes a member of the calcitonin family of peptide hormones. This hormone is released from pancreatic beta cells following food intake to regulate blood glucose levels and act as a satiation signal. Human patients with type 1 and advanced type 2 diabetes exhibit reduced levels of the encoded hormone in blood and pancreas. This protein also exhibits a bactericidal, antimicrobial activity.
• Molecular Mass: 9.81 kDa
• AA Sequence: MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: IAPP islet amyloid polypeptide [ Homo sapiens (human) ]
• Official Symbol: IAPP
• Synonyms: IAPP; islet amyloid polypeptide; DAP; IAP; islet amyloid polypeptide; Islet amyloid polypeptide (diabetes-associated peptide; amylin); amylin; diabetes-associated peptide; insulinoma amyloid peptide
• Gene ID: 3375
• mRNA Refseq: NM_000415
• Protein Refseq: NP_000406
• MIM: 147940
• UniProt ID: P10997