Recombinant Human IAH1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: IAH1-5068H
• Product Overview: IAH1 MS Standard C13 and N15-labeled recombinant protein (NP_001034702) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: IAH1 (Isoamyl Acetate Hydrolyzing Esterase 1 (Putative)) is a Protein Coding gene. Diseases associated with IAH1 include Inflammatory Skin And Bowel Disease, Neonatal, 1 and 3-Methylglutaconic Aciduria, Type I. Gene Ontology (GO) annotations related to this gene include hydrolase activity and hydrolase activity, acting on ester bonds.
• Molecular Mass: 27.6 kDa
• AA Sequence: MALCEAAGCGSALLWPRLLLFGDSITQFSFQQGGWGASLADRLVRKCDVLNRGFSGYNTRWAKIILPRLIRKGNSLDIPVAVTIFFGANDSALKDENPKQHIPLEEYAANLKSMVQYLKSVDIPENRVILITPTPLCETAWEEQCIIQGCKLNRLNSVVGEYANACLQVAQDCGTDVLDLWTLMQDSQDFSSYLSDGLHLSPKGNEFLFSHLWPLIEKKVSSLPLLLPYWRDVAEAKPELSLLGDGDHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: IAH1 isoamyl acetate hydrolyzing esterase 1 (putative) [ Homo sapiens (human) ]
• Official Symbol: IAH1
• Synonyms: IAH1; isoamyl acetate-hydrolyzing esterase 1 homolog (S. cerevisiae); isoamyl acetate-hydrolyzing esterase 1 homolog; MGC102860
• Gene ID: 285148
• mRNA Refseq: NM_001039613
• Protein Refseq: NP_001034702
• UniProt ID: Q2TAA2