Recombinant Human HYAL1 protein, His-tagged

• Cat.No.: HYAL1-12H
• Product Overview: Recombinant Human HYAL1(Phe22-Trp435) fused with His tag at C-terminal was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 22-435 a.a.
• Description: Hyaluronidase-1 (HYAL1) is a secreted lysosomal hyaluronidase that belongs to the glycosyl hydrolase 56 family. HYAL1 contains one EGF-like domain and is highly expressed in the liver, kidney, and heart, but it is weakly expressed in the lung, placenta, and skeletal muscle. HYAL1 is thought to be involved in cell proliferation, migration, and differentiation. It may play a role in promoting tumor progression and blocking the TGFB1-enhanced cell growth. Mutations in HYAL1 are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency.
• Form: Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 10%Glycerol, pH7.5.
• AA Sequence: FRGPLLPNRPFTTVWNANTQWCLERHGVDVDVSVFDVVANPGQTFRGPDMTIFYSSQLGTYPYYT PTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRS RALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPN YTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNL PVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGP FILNVTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQ MAVEFKCRCYPGWQAPWCERKSMWVDHHHHHH
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Store at < -20 centigrade, stable for 6 months after receipt.
  Please minimize freeze-thaw cycles.

Gene Information

• Gene Name: HYAL1 hyaluronoglucosaminidase 1 [ Homo sapiens ]
• Official Symbol: HYAL1
• Synonyms: HYAL1; hyaluronoglucosaminidase 1; hyaluronidase-1; FUS2; HYAL 1; LUCA1; NAT6; luCa-1; hyaluronidase 1; plasma hyaluronidase; tumor suppressor LUCA-1; lung carcinoma protein 1; hyaluronoglucosaminidase-1; HYAL-1; MGC45987
• Gene ID: 3373
• mRNA Refseq: NM_007312
• Protein Refseq: NP_009296
• MIM: 607071
• UniProt ID: Q12794