Recombinant Human HUNK Protein, GST-tagged
Cat.No. : | HUNK-5226H |
Product Overview : | Human HUNK partial ORF ( NP_055401, 615 a.a. - 714 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | HUNK (Hormonally Up-Regulated Neu-Associated Kinase) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is BRSK1. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | LHPTLVSFAHEDKNSPPKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIGQMLRKRHQSLQPSADRPLEASLPPLQPLAPVNLAFDMADGVKTQC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HUNK hormonally up-regulated Neu-associated kinase [ Homo sapiens ] |
Official Symbol | HUNK |
Synonyms | HUNK; hormonally up-regulated Neu-associated kinase; hormonally upregulated Neu associated kinase; hormonally up-regulated neu tumor-associated kinase; B19; serine/threonine protein kinase MAK-V; serine/threonine-protein kinase MAK-V; hormonally upregulated Neu-associated kinase; hormonally upregulated neu tumor-associated kinase; |
Gene ID | 30811 |
mRNA Refseq | NM_014586 |
Protein Refseq | NP_055401 |
MIM | 606532 |
UniProt ID | P57058 |
◆ Recombinant Proteins | ||
HUNK-46H | Recombinant Human HUNK, GST-tagged | +Inquiry |
HUNK-5226H | Recombinant Human HUNK Protein, GST-tagged | +Inquiry |
HUNK-4385M | Recombinant Mouse HUNK Protein, His (Fc)-Avi-tagged | +Inquiry |
HUNK-7947M | Recombinant Mouse HUNK Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HUNK Products
Required fields are marked with *
My Review for All HUNK Products
Required fields are marked with *
0
Inquiry Basket