Recombinant Human HUNK Protein, GST-tagged

• Cat.No.: HUNK-5226H
• Product Overview: Human HUNK partial ORF ( NP_055401, 615 a.a. - 714 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HUNK (Hormonally Up-Regulated Neu-Associated Kinase) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is BRSK1.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: LHPTLVSFAHEDKNSPPKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIGQMLRKRHQSLQPSADRPLEASLPPLQPLAPVNLAFDMADGVKTQC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HUNK hormonally up-regulated Neu-associated kinase [ Homo sapiens ]
• Official Symbol: HUNK
• Synonyms: HUNK; hormonally up-regulated Neu-associated kinase; hormonally upregulated Neu associated kinase; hormonally up-regulated neu tumor-associated kinase; B19; serine/threonine protein kinase MAK-V; serine/threonine-protein kinase MAK-V; hormonally upregulated Neu-associated kinase; hormonally upregulated neu tumor-associated kinase
• Gene ID: 30811
• mRNA Refseq: NM_014586
• Protein Refseq: NP_055401
• MIM: 606532
• UniProt ID: P57058