Recombinant Human HTR5A protein, GST-tagged

• Cat.No.: HTR5A-301334H
• Product Overview: Recombinant Human HTR5A (182-282 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Gly182-Arg282
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: GETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQR
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: HTR5A 5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled [ Homo sapiens ]
• Official Symbol: HTR5A
• Synonyms: HTR5A; 5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 5A; 5-hydroxytryptamine receptor 5A; 5 HT5A; 5-HT-5; 5-HT-5A; serotonin receptor 5A; 5-HT5A; MGC138226
• Gene ID: 3361
• mRNA Refseq: NM_024012
• Protein Refseq: NP_076917
• MIM: 601305
• UniProt ID: P47898