Recombinant Full Length Human HTR5A Protein, GST-tagged

• Cat.No.: HTR5A-5699HF
• Product Overview: Human HTR5A full-length ORF ( NP_076917.1, 1 a.a. - 357 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. The gene described in this record is a member of 5-hydroxytryptamine (serotonin) receptor family and encodes a multi-pass membrane protein that functions as a receptor for 5-hydroxytryptamine and couples to G-proteins. This protein has been shown to function in part through the regulation of intracellular Ca2+ mobilization. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 66.7 kDa
• Protein length: 357 amino acids
• AA Sequence: MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HTR5A 5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled [ Homo sapiens ]
• Official Symbol: HTR5A
• Synonyms: HTR5A; 5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 5A; 5-hydroxytryptamine receptor 5A; 5 HT5A; 5-HT-5; 5-HT-5A; serotonin receptor 5A; 5-HT5A; MGC138226
• Gene ID: 3361
• mRNA Refseq: NM_024012
• Protein Refseq: NP_076917
• MIM: 601305
• UniProt ID: P47898