Recombinant Human HTR3E Transmembrane protein (72-228 aa & 241-456 aa), His-SUMO-tagged

• Cat.No.: HTR3E-2714H
• Product Overview: Recombinant Human HTR3E Protein (72-228 aa & 241-456 aa) is produced by in vitro E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 72-228aa&241-456aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 58.2kDa
• AA Sequence: MSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRVAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLLPTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPGPAEAELTGGSEWTRAQREHEAQKQHSVELWLQFSHAMDAMLFRLYLLFMASSIITVICLWNT
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: HTR3E 5-hydroxytryptamine (serotonin) receptor 3E, ionotropic [ Homo sapiens ]
• Official Symbol: HTR3E
• Synonyms: HTR3E; 5-hydroxytryptamine (serotonin) receptor 3E, ionotropic; 5 hydroxytryptamine (serotonin) receptor 3, family member E; 5-hydroxytryptamine receptor 3E; 5-hydroxytryptamine receptor 3 subunit E; 5-hydroxytryptamine (serotonin) receptor 3, family member E; 5-HT3E; 5-HT3-E; 5-HT3c1; MGC120035; MGC120036; MGC120037
• Gene ID: 285242
• mRNA Refseq: NM_001256613
• Protein Refseq: NP_001243542
• MIM: 610123
• UniProt ID: A5X5Y0