Recombinant Human HTR3E Transmembrane protein (72-228 aa & 241-456 aa), His-SUMO-tagged
Cat.No. : | HTR3E-2714H |
Product Overview : | Recombinant Human HTR3E Protein (72-228 aa & 241-456 aa) is produced by in vitro E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 72-228aa&241-456aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 58.2kDa |
AA Sequence : | MSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRVAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLLPTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPGPAEAELTGGSEWTRAQREHEAQKQHSVELWLQFSHAMDAMLFRLYLLFMASSIITVICLWNT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | HTR3E 5-hydroxytryptamine (serotonin) receptor 3E, ionotropic [ Homo sapiens ] |
Official Symbol | HTR3E |
Synonyms | HTR3E; 5-hydroxytryptamine (serotonin) receptor 3E, ionotropic; 5 hydroxytryptamine (serotonin) receptor 3, family member E; 5-hydroxytryptamine receptor 3E; 5-hydroxytryptamine receptor 3 subunit E; 5-hydroxytryptamine (serotonin) receptor 3, family member E; 5-HT3E; 5-HT3-E; 5-HT3c1; MGC120035; MGC120036; MGC120037; |
Gene ID | 285242 |
mRNA Refseq | NM_001256613 |
Protein Refseq | NP_001243542 |
MIM | 610123 |
UniProt ID | A5X5Y0 |
◆ Recombinant Proteins | ||
HTR3E-2714H | Recombinant Human HTR3E Transmembrane protein (72-228 aa & 241-456 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTR3E-5332HCL | Recombinant Human HTR3E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HTR3E Products
Required fields are marked with *
My Review for All HTR3E Products
Required fields are marked with *
0
Inquiry Basket