Recombinant Human HSPB8 Protein
Cat.No. : | HSPB8-045H |
Product Overview : | Recombinant human HSPB8 protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 196 |
Description : | The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. |
Form : | Lyophilized |
Molecular Mass : | 21 kDa |
AA Sequence : | MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT |
Purity : | > 95% |
Applications : | WB; Proliferation Assay; |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | Tris-acetate (pH 7.6). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | HSPB8 heat shock 22kDa protein 8 [ Homo sapiens (human) ] |
Official Symbol | HSPB8 |
Synonyms | HSPB8; heat shock 22kDa protein 8; heat shock 27kDa protein 8; heat shock protein beta-8; E2IG1; H11; HSP22; HspB8; protein kinase H11; alpha-crystallin C chain; E2-induced gene 1 protein; small stress protein-like protein HSP22; HMN2; CMT2L; DHMN2; HMN2A; |
Gene ID | 26353 |
mRNA Refseq | NM_014365 |
Protein Refseq | NP_055180 |
MIM | 608014 |
UniProt ID | Q9UJY1 |
◆ Recombinant Proteins | ||
HSPB8-5120H | Recombinant Human HSPB8 Protein, GST-tagged | +Inquiry |
HSPB8-045H | Recombinant Human HSPB8 Protein | +Inquiry |
HSPB8-27526TH | Recombinant Human HSPB8, His-tagged | +Inquiry |
Hspb8-3457M | Recombinant Mouse Hspb8 Protein, Myc/DDK-tagged | +Inquiry |
HSPB8-29389TH | Recombinant Human HSPB8 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPB8-5345HCL | Recombinant Human HSPB8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSPB8 Products
Required fields are marked with *
My Review for All HSPB8 Products
Required fields are marked with *
0
Inquiry Basket