Recombinant Human HSPB2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: HSPB2-5319H
• Product Overview: HSPB2 MS Standard C13 and N15-labeled recombinant protein (NP_001532) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The protein is expressed preferentially in the heart and skeletal muscle. This protein regulates Myotonic Dystrophy Protein Kinase, which plays an important role in maintenance of muscle structure and function.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 20.2 kDa
• AA Sequence: MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: HSPB2 heat shock 27kDa protein 2 [ Homo sapiens (human) ]
• Official Symbol: HSPB2
• Synonyms: HSPB2; heat shock 27kDa protein 2; heat shock 27kD protein 2; heat shock protein beta-2; Hs.78846; MKBP; DMPK-binding protein; heat-shock protein beta-2; HSP27; LOH11CR1K; MGC133245
• Gene ID: 3316
• mRNA Refseq: NM_001541
• Protein Refseq: NP_001532
• MIM: 602179
• UniProt ID: Q16082