Recombinant Human HSPB2 protein, GST-tagged

• Cat.No.: HSPB2-4384H
• Product Overview: Recombinant Human HSPB2 protein(Q16082)(1-182aa), fused to N-terminal GST tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-182aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 47.2 kDa
• AA Sequence: MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: HSPB2 heat shock 27kDa protein 2 [ Homo sapiens ]
• Official Symbol: HSPB2
• Synonyms: HSPB2; heat shock 27kDa protein 2; heat shock 27kD protein 2; heat shock protein beta-2; Hs.78846; MKBP; DMPK-binding protein; heat-shock protein beta-2; HSP27; LOH11CR1K; MGC133245
• Gene ID: 3316
• mRNA Refseq: NM_001541
• Protein Refseq: NP_001532
• MIM: 602179
• UniProt ID: Q16082