Recombinant Human HSPB1 Protein
Cat.No. : | HSPB1-046H |
Product Overview : | Recombinant human HSPB1 protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 205 |
Description : | This gene encodes a member of the small heat shock protein (HSP20) family of proteins. In response to environmental stress, the encoded protein translocates from the cytoplasm to the nucleus and functions as a molecular chaperone that promotes the correct folding of other proteins. This protein plays an important role in the differentiation of a wide variety of cell types. Expression of this gene is correlated with poor clinical outcome in multiple human cancers, and the encoded protein may promote cancer cell proliferation and metastasis, while protecting cancer cells from apoptosis. Mutations in this gene have been identified in human patients with Charcot-Marie-Tooth disease and distal hereditary motor neuropathy. |
Form : | Solution |
Molecular Mass : | 22.7 kDa |
AA Sequence : | MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK |
Purity : | > 95% |
Applications : | WB |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | 4°C |
Concentration : | 1 mg/mL |
Storage Buffer : | HEPES (pH 7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | HSPB1 heat shock 27kDa protein 1 [ Homo sapiens (human) ] |
Official Symbol | HSPB1 |
Synonyms | HSPB1; heat shock 27kDa protein 1; heat shock 27kD protein 1; heat shock protein beta-1; Hs.76067; Hsp25; HSP27; HSP28; HSP 27; 28 kDa heat shock protein; heat shock 27 kDa protein; stress-responsive protein 27; estrogen-regulated 24 kDa protein; CMT2F; HMN2B; SRP27; HS.76067; DKFZp586P1322; |
Gene ID | 3315 |
mRNA Refseq | NM_001540 |
Protein Refseq | NP_001531 |
MIM | 602195 |
UniProt ID | P04792 |
◆ Recombinant Proteins | ||
HSPB1-2950R | Recombinant Rat HSPB1 Protein | +Inquiry |
HSPB1-3964HF | Recombinant Full Length Human HSPB1 Protein, GST-tagged | +Inquiry |
HSPB1-27737TH | Recombinant Human HSPB1 | +Inquiry |
HSPB1-1553H | Recombinant Human HSPB1 protein | +Inquiry |
HSPB1-7913M | Recombinant Mouse HSPB1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPB1-5351HCL | Recombinant Human HSPB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSPB1 Products
Required fields are marked with *
My Review for All HSPB1 Products
Required fields are marked with *
0
Inquiry Basket