Recombinant Human HSPB1 protein(61-200 aa), C-His-tagged

• Cat.No.: HSPB1-2549H
• Product Overview: Recombinant Human HSPB1 protein(P04792)(61-200 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 61-200 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: AAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSD

Gene Information

• Gene Name: HSPB1 heat shock 27kDa protein 1 [ Homo sapiens ]
• Official Symbol: HSPB1
• Synonyms: HSPB1; heat shock 27kDa protein 1; heat shock 27kD protein 1; heat shock protein beta-1; Hs.76067; Hsp25; HSP27; HSP28; HSP 27; 28 kDa heat shock protein; heat shock 27 kDa protein; stress-responsive protein 27; estrogen-regulated 24 kDa protein; CMT2F; HMN2B; SRP27; HS.76067; DKFZp586P1322
• Gene ID: 3315
• mRNA Refseq: NM_001540
• Protein Refseq: NP_001531
• MIM: 602195
• UniProt ID: P04792