Recombinant Human HSF2BP Protein, GST-tagged

• Cat.No.: HSF2BP-5089H
• Product Overview: Human HSF2BP full-length ORF ( NP_008962.1, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HSF2 binding protein (HSF2BP) associates with HSF2. The interaction occurs between the trimerization domain of HSF2 and the amino terminal hydrophilic region of HSF2BP that comprises two leucine zipper motifs. HSF2BP may therefore be involved in modulating HSF2 activation. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 64 kDa
• AA Sequence: MGEAGAAEEACRHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIVEKNLERKEQELEQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEVVKAILGGDKALKFFSITGQTMESFVKSLDGDVQELDSDESQFVFALAGIVTNVAAIACGREFLVNSSRVLLDTILQLLGDLKPGQCTKLKVLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQSVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HSF2BP heat shock transcription factor 2 binding protein [ Homo sapiens ]
• Official Symbol: HSF2BP
• Synonyms: HSF2BP; heat shock transcription factor 2 binding protein; heat shock factor 2-binding protein; heat shock factor 2 binding protein
• Gene ID: 11077
• mRNA Refseq: NM_007031
• Protein Refseq: NP_008962
• MIM: 604554
• UniProt ID: O75031