Recombinant Human HSDL1 Protein, GST-tagged

• Cat.No.: HSDL1-5083H
• Product Overview: Human HSDL1 full-length ORF ( NP_113651.3, 1 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HSDL1 (Hydroxysteroid Dehydrogenase Like 1) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity. An important paralog of this gene is HSD17B12.
• Molecular Mass: 63.4 kDa
• AA Sequence: MAAVDSFYLLYREIARSCNCYMEALALVGAWYTARKSITVICDFYSLIRLHFIPRLGSRADLIKQYGRWAVVSGATDGIGKAYAEELASRGLNIILISRNEEKLQVVAKDIADTYKVETDIIVADFSSGREIYLPIREALKDKDVGILVNNVGVFYPYPQYFTQLSEDKLWDIINVNIAAASLMVHVVLPGMVERKKGAIVTISSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYASKGIFVQSLIPFYVATSMTAPSNFLHRCSWLVPSPKVYAHHAVSTLGISKRTTGYWSHSIQFLFAQYMPEWLWVWGANILNRSLRKEALCCTA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HSDL1 hydroxysteroid dehydrogenase like 1 [ Homo sapiens ]
• Official Symbol: HSDL1
• Synonyms: HSDL1; hydroxysteroid dehydrogenase like 1; inactive hydroxysteroid dehydrogenase-like protein 1; SDR12C3; short chain dehydrogenase/reductase family 12C; member 3; steroid dehydrogenase-like protein; short chain dehydrogenase/reductase family 12C, member 3; MGC125994; MGC125995; MGC126032
• Gene ID: 83693
• mRNA Refseq: NM_001146051
• Protein Refseq: NP_001139523
• UniProt ID: Q3SXM5