Recombinant Full Length Human HSDL1 Protein, GST-tagged
Cat.No. : | HSDL1-3885HF |
Product Overview : | Human HSDL1 full-length ORF ( NP_113651.3, 1 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 330 amino acids |
Description : | HSDL1 (Hydroxysteroid Dehydrogenase Like 1) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity. An important paralog of this gene is HSD17B12. |
Molecular Mass : | 63.4 kDa |
AA Sequence : | MAAVDSFYLLYREIARSCNCYMEALALVGAWYTARKSITVICDFYSLIRLHFIPRLGSRADLIKQYGRWAVVSGATDGIGKAYAEELASRGLNIILISRNEEKLQVVAKDIADTYKVETDIIVADFSSGREIYLPIREALKDKDVGILVNNVGVFYPYPQYFTQLSEDKLWDIINVNIAAASLMVHVVLPGMVERKKGAIVTISSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYASKGIFVQSLIPFYVATSMTAPSNFLHRCSWLVPSPKVYAHHAVSTLGISKRTTGYWSHSIQFLFAQYMPEWLWVWGANILNRSLRKEALCCTA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HSDL1 hydroxysteroid dehydrogenase like 1 [ Homo sapiens ] |
Official Symbol | HSDL1 |
Synonyms | HSDL1; hydroxysteroid dehydrogenase like 1; inactive hydroxysteroid dehydrogenase-like protein 1; SDR12C3; short chain dehydrogenase/reductase family 12C; member 3; steroid dehydrogenase-like protein; short chain dehydrogenase/reductase family 12C, member 3; MGC125994; MGC125995; MGC126032; |
Gene ID | 83693 |
mRNA Refseq | NM_001146051 |
Protein Refseq | NP_001139523 |
MIM | 619067 |
UniProt ID | Q3SXM5 |
◆ Recombinant Proteins | ||
HSDL1-2158R | Recombinant Rhesus monkey HSDL1 Protein, His-tagged | +Inquiry |
HSDL1-3885HF | Recombinant Full Length Human HSDL1 Protein, GST-tagged | +Inquiry |
Hsdl1-3445M | Recombinant Mouse Hsdl1 Protein, Myc/DDK-tagged | +Inquiry |
HSDL1-2592R | Recombinant Rat HSDL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSDL1-2937R | Recombinant Rat HSDL1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSDL1-5367HCL | Recombinant Human HSDL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSDL1 Products
Required fields are marked with *
My Review for All HSDL1 Products
Required fields are marked with *
0
Inquiry Basket