Recombinant Human HSD11B2
Cat.No. : | HSD11B2-27734TH |
Product Overview : | Recombinant fragment of Human HSD11B2 with N-terminal proprietary tag.Mol Wt 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | There are at least two isozymes of the corticosteroid 11-beta-dehydrogenase, a microsomal enzyme complex responsible for the interconversion of cortisol and cortisone. The type I isozyme has both 11-beta-dehydrogenase (cortisol to cortisone) and 11-oxoreductase (cortisone to cortisol) activities. The type II isozyme, encoded by this gene, has only 11-beta-dehydrogenase activity. In aldosterone-selective epithelial tissues such as the kidney, the type II isozyme catalyzes the glucocorticoid cortisol to the inactive metabolite cortisone, thus preventing illicit activation of the mineralocorticoid receptor. In tissues that do not express the mineralocorticoid receptor, such as the placenta and testis, it protects cells from the growth-inhibiting and/or pro-apoptotic effects of cortisol, particularly during embryonic development. Mutations in this gene cause the syndrome of apparent mineralocorticoid excess and hypertension. |
Molecular Weight : | 36.630kDa |
Tissue specificity : | Found in placenta, kidney, pancreas, prostate, ovary, small intestine and colon. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGH |
Sequence Similarities : | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
Gene Name | HSD11B2 hydroxysteroid (11-beta) dehydrogenase 2 [ Homo sapiens ] |
Official Symbol | HSD11B2 |
Synonyms | HSD11B2; hydroxysteroid (11-beta) dehydrogenase 2; corticosteroid 11-beta-dehydrogenase isozyme 2; SDR9C3; short chain dehydrogenase/reductase family 9C; member 3; |
Gene ID | 3291 |
mRNA Refseq | NM_000196 |
Protein Refseq | NP_000187 |
MIM | 614232 |
Uniprot ID | P80365 |
Chromosome Location | 16q22 |
Pathway | Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone, organism-specific biosystem; C21-Steroid hormone biosynthesis, progesterone => |
Function | 11-beta-hydroxysteroid dehydrogenase [NAD(P)] activity; NAD binding; oxidoreductase activity; steroid binding; |
◆ Recombinant Proteins | ||
HSD11B2-4331M | Recombinant Mouse HSD11B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD11B2-6948HF | Recombinant Full Length Human HSD11B2 Protein, GST-tagged | +Inquiry |
Hsd11b2-1176M | Recombinant Mouse Hsd11b2 Protein, MYC/DDK-tagged | +Inquiry |
HSD11B2-1416H | Recombinant Human HSD11B2 Protein (1-405 aa), His-tagged | +Inquiry |
HSD11B2-27734TH | Recombinant Human HSD11B2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD11B2-5378HCL | Recombinant Human HSD11B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD11B2 Products
Required fields are marked with *
My Review for All HSD11B2 Products
Required fields are marked with *