Recombinant Human HSD11B2

Cat.No. : HSD11B2-27734TH
Product Overview : Recombinant fragment of Human HSD11B2 with N-terminal proprietary tag.Mol Wt 36.63 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : There are at least two isozymes of the corticosteroid 11-beta-dehydrogenase, a microsomal enzyme complex responsible for the interconversion of cortisol and cortisone. The type I isozyme has both 11-beta-dehydrogenase (cortisol to cortisone) and 11-oxoreductase (cortisone to cortisol) activities. The type II isozyme, encoded by this gene, has only 11-beta-dehydrogenase activity. In aldosterone-selective epithelial tissues such as the kidney, the type II isozyme catalyzes the glucocorticoid cortisol to the inactive metabolite cortisone, thus preventing illicit activation of the mineralocorticoid receptor. In tissues that do not express the mineralocorticoid receptor, such as the placenta and testis, it protects cells from the growth-inhibiting and/or pro-apoptotic effects of cortisol, particularly during embryonic development. Mutations in this gene cause the syndrome of apparent mineralocorticoid excess and hypertension.
Molecular Weight : 36.630kDa
Tissue specificity : Found in placenta, kidney, pancreas, prostate, ovary, small intestine and colon.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGH
Sequence Similarities : Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Gene Name HSD11B2 hydroxysteroid (11-beta) dehydrogenase 2 [ Homo sapiens ]
Official Symbol HSD11B2
Synonyms HSD11B2; hydroxysteroid (11-beta) dehydrogenase 2; corticosteroid 11-beta-dehydrogenase isozyme 2; SDR9C3; short chain dehydrogenase/reductase family 9C; member 3;
Gene ID 3291
mRNA Refseq NM_000196
Protein Refseq NP_000187
MIM 614232
Uniprot ID P80365
Chromosome Location 16q22
Pathway Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone, organism-specific biosystem; C21-Steroid hormone biosynthesis, progesterone =>
Function 11-beta-hydroxysteroid dehydrogenase [NAD(P)] activity; NAD binding; oxidoreductase activity; steroid binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSD11B2 Products

Required fields are marked with *

My Review for All HSD11B2 Products

Required fields are marked with *

0
cart-icon