Recombinant Human HPSE2 Protein, His-tagged
Cat.No. : | HPSE2-1037H |
Product Overview : | Recombinant Human HPSE2 protein (41-592) was expressed in HEK 293 cells with C-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
ProteinLength : | 41-592 a.a. |
Form : | PBS, 10% Glycerol. |
Molecular Mass : | 64 kDa |
AA Sequence : | AGDRRPLPVDRAAGLKEKTLILLDVSTKNPVRTVNENFLSLQLDPSIIHDGWLDFLSSKRLVTLARGLSPAFLRFGGKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGC KIAQHPDVMLELQREKAAQMHLVLLKEQFSNTYSNLILTARSLDKLYNFADCSGLHLIFALNALRRNPNNSWNSSSALSLLKYSASKKYNISWELGNEPNNYRTMHGRAVNGSQLGKDYIQLKS LLQPIRIYSRASLYGPNIGRPRKNVIALLDGFMKVAGSTVDAVTWQHCYIDGRVVKVMDFLKTRLLDTLSDQIRKIQKVVNTYTPGKKIWLEGVVTTSAGGTNNLSDSYAAGFLWLNTLGMLAN QGIDVVIRHSFFDHGYNHLVDQNFNPLPDYWLSLLYKRLIGPKVLAVHVAGLQRKPRPGRVIRDKLRIYAHCTNHHNHNYVRGSITLFIINLHRSRKKIKLAGTLRDKLVHQYLLQPYGQEGLK SKSVQLNGQPLVMVDDGTLPELKPRPLRAGRTLVIPPVTMGFYVVKNVNALACRYRGGGCCPGCCGGSGHHHHHHHHHH |
Storage : | The protein should be stored at -20 centigrade to -70 centigrade preferably in small aliquots to avoid repeated freeze-thaw cycles. |
Gene Name | HPSE2 heparanase 2 (inactive) [ Homo sapiens (human) ] |
Official Symbol | HPSE2 |
Synonyms | UFS; HPA2; HPR2; UFS1 |
Gene ID | 60495 |
mRNA Refseq | NM_021828.4 |
Protein Refseq | NP_068600.4 |
MIM | 613469 |
UniProt ID | Q8WWQ2 |
◆ Recombinant Proteins | ||
RFL24190BF | Recombinant Full Length Brucella Melitensis Biotype 1 Large-Conductance Mechanosensitive Channel(Mscl) Protein, His-Tagged | +Inquiry |
MYOG-5853H | Recombinant Human MYOG Protein, GST-tagged | +Inquiry |
RCOR2-7503M | Recombinant Mouse RCOR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
INSIG1-124H | Recombinant Human INSIG1, His-tagged | +Inquiry |
PRKCDBP-7094M | Recombinant Mouse PRKCDBP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
ALP-151P | Active Native Porcine Kidney Alkaline Phosphatase | +Inquiry |
Neuraminidase-013C | Active Native Clostridium perfringens Neuraminidase Agarose, Type VI-A | +Inquiry |
C7-56H | Native Human Complement C7 | +Inquiry |
LTF-312H | Native Human LTF protein | +Inquiry |
MAP-30 | Native Mytilus edulis MAP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ID2-5311HCL | Recombinant Human ID2 293 Cell Lysate | +Inquiry |
Pancreas-358H | Human Pancreas Cytoplasmic Tumor Lysate | +Inquiry |
IL19-5242HCL | Recombinant Human IL19 293 Cell Lysate | +Inquiry |
PDCD5-3360HCL | Recombinant Human PDCD5 293 Cell Lysate | +Inquiry |
PPP1CB-2950HCL | Recombinant Human PPP1CB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HPSE2 Products
Required fields are marked with *
My Review for All HPSE2 Products
Required fields are marked with *
0
Inquiry Basket