Recombinant Human HPS6 protein, GST-tagged
Cat.No. : | HPS6-3627H |
Product Overview : | Recombinant Human HPS6 protein(476-775 aa), fused to GST tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 476-775 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | DDEEAGWTELAEQEVARLLRTELIGDQLAQLNTVFQALPTAAWGATLRALQLQLDGNGKLRSQAPPDVWKKVLGGITAGKEPPNGILPPFELLCQCLCQLEPRWLPPFVELAQQQGGPGWGAGGPGLPLYRRALAVLGEEGTRPEALELELLLSSGRPKAVLQAVGQLVQKEQWDRALDAGLALGPSSPLLRSEIFKLLLAEFAQHRRLDAHLPLLCRLCPPELAPAELLLLLRTYLPDEVGPPTPFPEPGAEPPLTVGLLKALLEQTGAQGWLSGPVLSPYEDILWDPSTPPPTPPRDL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | HPS6 Hermansky-Pudlak syndrome 6 [ Homo sapiens ] |
Official Symbol | HPS6 |
Synonyms | HPS6; Hermansky-Pudlak syndrome 6; Hermansky-Pudlak syndrome 6 protein; FLJ22501; ruby-eye protein homolog; Hermansky-Pudlak syndrome-6 protein (HPS6); MGC20522; RP11-302K17.1; |
Gene ID | 79803 |
mRNA Refseq | NM_024747 |
Protein Refseq | NP_079023 |
MIM | 607522 |
UniProt ID | Q86YV9 |
◆ Recombinant Proteins | ||
HPS6-5018H | Recombinant Human HPS6 Protein, GST-tagged | +Inquiry |
HPS6-4311M | Recombinant Mouse HPS6 Protein, His (Fc)-Avi-tagged | +Inquiry |
HPS6-1960R | Recombinant Rhesus Macaque HPS6 Protein, His (Fc)-Avi-tagged | +Inquiry |
HPS6-2561R | Recombinant Rat HPS6 Protein, His (Fc)-Avi-tagged | +Inquiry |
HPS6-2906R | Recombinant Rat HPS6 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HPS6 Products
Required fields are marked with *
My Review for All HPS6 Products
Required fields are marked with *
0
Inquiry Basket