Recombinant Human HPS6 Protein, GST-tagged

• Cat.No.: HPS6-5018H
• Product Overview: Human HPS6 partial ORF ( NP_079023, 400 a.a. - 500 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This intronless gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. This protein interacts with Hermansky-Pudlak syndrome 5 protein. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 6. [provided by RefSeq
• Molecular Mass: 36.85 kDa
• AA Sequence: KDLVFEEACGYYQRRSLRGAQLTPEELRHSSTFRAPQALASILQGHLPPSALLTMLRTELRDYRGLEQLKAQLVAGDDEEAGWTELAEQEVARLLRTELIG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HPS6 Hermansky-Pudlak syndrome 6 [ Homo sapiens ]
• Official Symbol: HPS6
• Synonyms: HPS6; Hermansky-Pudlak syndrome 6; Hermansky-Pudlak syndrome 6 protein; FLJ22501; ruby-eye protein homolog; Hermansky-Pudlak syndrome-6 protein (HPS6); MGC20522; RP11-302K17.1
• Gene ID: 79803
• mRNA Refseq: NM_024747
• Protein Refseq: NP_079023
• MIM: 607522
• UniProt ID: Q86YV9