Recombinant Human HPS6 Protein, GST-tagged
Cat.No. : | HPS6-5018H |
Product Overview : | Human HPS6 partial ORF ( NP_079023, 400 a.a. - 500 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This intronless gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. This protein interacts with Hermansky-Pudlak syndrome 5 protein. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 6. [provided by RefSeq |
Molecular Mass : | 36.85 kDa |
AA Sequence : | KDLVFEEACGYYQRRSLRGAQLTPEELRHSSTFRAPQALASILQGHLPPSALLTMLRTELRDYRGLEQLKAQLVAGDDEEAGWTELAEQEVARLLRTELIG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HPS6 Hermansky-Pudlak syndrome 6 [ Homo sapiens ] |
Official Symbol | HPS6 |
Synonyms | HPS6; Hermansky-Pudlak syndrome 6; Hermansky-Pudlak syndrome 6 protein; FLJ22501; ruby-eye protein homolog; Hermansky-Pudlak syndrome-6 protein (HPS6); MGC20522; RP11-302K17.1; |
Gene ID | 79803 |
mRNA Refseq | NM_024747 |
Protein Refseq | NP_079023 |
MIM | 607522 |
UniProt ID | Q86YV9 |
◆ Recombinant Proteins | ||
HPS6-2139R | Recombinant Rhesus monkey HPS6 Protein, His-tagged | +Inquiry |
HPS6-1960R | Recombinant Rhesus Macaque HPS6 Protein, His (Fc)-Avi-tagged | +Inquiry |
HPS6-2561R | Recombinant Rat HPS6 Protein, His (Fc)-Avi-tagged | +Inquiry |
HPS6-3627H | Recombinant Human HPS6 protein, GST-tagged | +Inquiry |
HPS6-7837M | Recombinant Mouse HPS6 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HPS6 Products
Required fields are marked with *
My Review for All HPS6 Products
Required fields are marked with *
0
Inquiry Basket