Recombinant Human HPCAL4 Protein, GST-tagged

• Cat.No.: HPCAL4-5005H
• Product Overview: Human HPCAL4 full-length ORF ( AAH30827, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is highly similar to human hippocalcin protein and hippocalcin like-1 protein. It also has similarity to rat neural visinin-like Ca2+-binding protein-type 1 and 2 proteins. This encoded protein may be involved in the calcium-dependent regulation of rhodopsin phosphorylation. The transcript of this gene has multiple polyadenylation sites. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 46.75 kDa
• AA Sequence: MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRMNQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDASIVLLLQCDMQK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HPCAL4 hippocalcin like 4 [ Homo sapiens ]
• Official Symbol: HPCAL4
• Synonyms: HPCAL4; hippocalcin like 4; hippocalcin-like protein 4; DKFZp761G122; HLP4
• Gene ID: 51440
• mRNA Refseq: NM_016257
• Protein Refseq: NP_057341
• UniProt ID: Q9UM19