Recombinant Human HPCAL4 Protein, GST-tagged

Cat.No. : HPCAL4-5005H
Product Overview : Human HPCAL4 full-length ORF ( AAH30827, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is highly similar to human hippocalcin protein and hippocalcin like-1 protein. It also has similarity to rat neural visinin-like Ca2+-binding protein-type 1 and 2 proteins. This encoded protein may be involved in the calcium-dependent regulation of rhodopsin phosphorylation. The transcript of this gene has multiple polyadenylation sites. [provided by RefSeq
Molecular Mass : 46.75 kDa
AA Sequence : MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRMNQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDASIVLLLQCDMQK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HPCAL4 hippocalcin like 4 [ Homo sapiens ]
Official Symbol HPCAL4
Synonyms HPCAL4; hippocalcin like 4; hippocalcin-like protein 4; DKFZp761G122; HLP4;
Gene ID 51440
mRNA Refseq NM_016257
Protein Refseq NP_057341
UniProt ID Q9UM19

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HPCAL4 Products

Required fields are marked with *

My Review for All HPCAL4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon