Recombinant Human HPCAL1 Protein, GST-tagged

• Cat.No.: HPCAL1-5004H
• Product Overview: Human HPCAL1 full-length ORF ( NP_002140.2, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. It is highly similar to human hippocalcin protein and nearly identical to the rat and mouse hippocalcin like-1 proteins. It may be involved in the calcium-dependent regulation of rhodopsin phosphorylation and may be of relevance for neuronal signalling in the central nervous system. There are two alternatively spliced transcript variants of this gene, with multiple polyadenylation sites. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 48.7 kDa
• AA Sequence: MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HPCAL1 hippocalcin-like 1 [ Homo sapiens ]
• Official Symbol: HPCAL1
• Synonyms: HPCAL1; hippocalcin-like 1; hippocalcin-like protein 1; BDR1; calcium binding protein BDR 1; HLP2; VILIP 3; visinin like protein 3; visinin-like protein 3; calcium-binding protein BDR-1; VILIP-3
• Gene ID: 3241
• mRNA Refseq: NM_002149
• Protein Refseq: NP_002140
• MIM: 600207
• UniProt ID: P37235