Recombinant Human HPCAL1, His-tagged

• Cat.No.: HPCAL1-30156TH
• Product Overview: Recombinant full length Human VILIP3 with an N terminal His tag; 213 amino acids with a predicted MWt 24.4kDa including tag.

Specification

• Description: The protein encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. It is highly similar to human hippocalcin protein and nearly identical to the rat and mouse hippocalcin like-1 proteins. It may be involved in the calcium-dependent regulation of rhodopsin phosphorylation and may be of relevance for neuronal signalling in the central nervous system. There are two alternatively spliced transcript variants of this gene, with multiple polyadenylation sites.
• Protein length: 193 amino acids
• Conjugation: HIS
• Molecular Weight: 24.400kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF

Gene Information

• Gene Name: HPCAL1 hippocalcin-like 1 [ Homo sapiens ]
• Official Symbol: HPCAL1
• Synonyms: HPCAL1; hippocalcin-like 1; hippocalcin-like protein 1; BDR1; calcium binding protein BDR 1; HLP2; VILIP 3; visinin like protein 3
• Gene ID: 3241
• mRNA Refseq: NM_002149
• Protein Refseq: NP_002140
• MIM: 600207
• Uniprot ID: P37235
• Chromosome Location: 2p25.1
• Function: calcium ion binding